PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001641m
Common NameCICLE_v10001613mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 358aa    MW: 39324.9 Da    PI: 9.1647
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001641mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.97.5e-2374118145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++ +++k+CErH++r+r rsrk++e+
  Ciclev10001641m  74 DPEPGRCRRTDGKKWRCSKDAHPNSKYCERHMNRSRYRSRKPVES 118
                      79****************************************986 PP

2QLQ59.21.2e-201347236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                     +FTa+Q+++L++Q+l++KyL a++PvPp+Ll++i+
  Ciclev10001641m 13 PFTASQWHELEHQALIFKYLKAGLPVPPDLLVPIR 47
                     9********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.7E-121248IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.2E-161347IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.5031348IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.4574118IPR014977WRC domain
PfamPF088794.3E-1975117IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MSGSGSLSSS VAPFTASQWH ELEHQALIFK YLKAGLPVPP DLLVPIRTSL KFLSSSLFHH  60
PTFGYCSYFG KKIDPEPGRC RRTDGKKWRC SKDAHPNSKY CERHMNRSRY RSRKPVESQN  120
TSQSLSTTVG VDIGGNRSSI GSGGGGGGGS RSLSFQNPPL QPLSTREGIC FRSNMSQSQM  180
AAIPYGIPNK EYRLQELKPE GNDGVLSMAS ESLRGFTMNS SVDNSWCVTT SGSSSIPLSD  240
QRSGAFLQNS CLPMQTLQDF DSLIGNGATS KQQQQHYFFG REFDSSRSQK QEHQALQPLP  300
DELPKTIDFG YYLDDQRANK SSLSTTQLSM STPIASSKFF ETSAHSSKDT SMDKFLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432587.10.0hypothetical protein CICLE_v10001613mg
RefseqXP_006493632.10.0PREDICTED: growth-regulating factor 4-like isoform X2
TrEMBLV4SYE50.0V4SYE5_9R
STRINGPOPTR_0001s01480.11e-110(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-37growth-regulating factor 5